PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa003869
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family GRF
Protein Properties Length: 153aa    MW: 17032.1 Da    PI: 8.6072
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-17047PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.51.4e-2495139145
        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                +aepgrC+RtDGKkWRCs++v+ g+k+CE+Hlhrgrsrsrk +e+
  Lsa003869  95 EAEPGRCKRTDGKKWRCSKEVVIGYKYCEKHLHRGRSRSRKDVEA 139
                58***************************************9986 PP

2QLQ483.9e-174071637
        QLQ  6 aQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
               +Q ++Lk Q+l+yKy+ a++PvP++Ll++i++
  Lsa003869 40 MQMEELKLQALIYKYMEAGLPVPSNLLLPIWN 71
               7******************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5166617.2163671IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.4E-114070IPR014978Glutamine-Leucine-Glutamine, QLQ
SMARTSM009514.2E-44171IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.51995139IPR014977WRC domain
PfamPF088795.5E-2196138IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MNGVEGSSSS AADSSSFLEQ NANYMSVLGM NGGTVVHHXM QMEELKLQAL IYKYMEAGLP  60
VPSNLLLPIW NSVLASFTGS GCDRSLYDNY KNSMEAEPGR CKRTDGKKWR CSKEVVIGYK  120
YCEKHLHRGR SRSRKDVEAD SMVAATDGRH KNL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009385239.11e-42PREDICTED: growth-regulating factor 10-like
SwissprotQ6AWX77e-43GRF12_ORYSJ; Growth-regulating factor 12
TrEMBLA0A103XG441e-73A0A103XG44_CYNCS; Glutamine-Leucine-Glutamine, QLQ
STRINGGSMUA_Achr11P21590_0012e-42(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.13e-33growth-regulating factor 3